动物模型与人类重大疾病机理重点实验室知识库

QQ客服 官方微博 反馈留言

	An insecticidal toxin from Nephila clavata spider venom
	Jin L1; Fang MQ1; Hakim MA2; Mo GX1; Lai R2,3; Yan XW *1; Wang YM*4; Yang SL*2; Chen MR1; Zhou CL1; Ombati R2,3,5; wangym992011@163.com
	2017
发表期刊	Amino Acids
卷号	**期号:**页码:published online
摘要	Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaV and KV channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.
关键词	Toxin Spider Venom Nephila Clavata Bioinsecticide
资助者	This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y.
语种	英语
资助者	This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y. ; This work was supported by funding from the Ministry of Science and Technology of China (2013CB911304), National Science Foundation of China (331372208 and U1302221), Chinese Academy of Sciences (XDA12040209, QYZDJ-SSW-SMC012), Science and technology office of Jiangsu Province (BE2016742) and Yunnan Province (2015HA023) to R.L., National Science Foundation of China (31640071) and Chinese Academy of Sciences (XDA12020334 and Youth Innovation Promo- tion Association) to S.Y., and National Science Foundation of China (31201717), Jiangsu Province (Q0201600440) to X.W.Y.
文献类型	期刊论文
条目标识符	http://ir.kiz.ac.cn/handle/152453/11495
专题	科研部门_动物模型与人类重大疾病机理重点实验室 科研部门_天然药物功能蛋白质学科组（赖仞）
通讯作者	wangym992011@163.com
作者单位	1.College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, Jiangsu, China 2.Key Laboratory of Animal Models and Human Disease Mechanisms, Chinese Academy of Sciences and Yunnan Province, Kunming Institute of Zoology, Kunming 650223, Yunnan, China 3.Sino-African Joint Research Center, CAS, Kunming Institute of Zoology, Kunming 650223, Yunnan, China 4.Clinical Laboratory, The Second Affiliated Hospital of Kunming Medical University, Kunming 650101, Yunnan, China 5.University of Chinese Academy of Sciences, Beijing 100009, China
推荐引用方式 GB/T 7714	Jin L,Fang MQ,Hakim MA,et al. An insecticidal toxin from Nephila clavata spider venom[J]. Amino Acids,2017,**(**):published online.
APA	Jin L.,Fang MQ.,Hakim MA.,Mo GX.,Lai R.,...&wangym992011@163.com.(2017).An insecticidal toxin from Nephila clavata spider venom.Amino Acids,**(**),published online.
MLA	Jin L,et al."An insecticidal toxin from Nephila clavata spider venom".Amino Acids **.**(2017):published online.

条目包含的文件
文件名称/大小	文献类型	版本类型	开放类型	使用许可
50999999.pdf（955KB）	期刊论文	出版稿	开放获取	CC BY-NC-SA	请求全文

个性服务

推荐该条目

保存到收藏夹

查看访问统计

导出为Endnote文件

谷歌学术

谷歌学术中相似的文章

[Jin L]的文章

[Fang MQ]的文章

[Hakim MA]的文章

百度学术

百度学术中相似的文章

[Jin L]的文章

[Fang MQ]的文章

[Hakim MA]的文章

必应学术

必应学术中相似的文章

[Jin L]的文章

[Fang MQ]的文章

[Hakim MA]的文章

相关权益政策

暂无数据

收藏/分享

除非特别说明，本系统中所有内容都受版权保护，并保留所有权利。