天然药物功能蛋白质学科组（赖仞）知识库

QQ客服 官方微博 反馈留言

	A novel bioactive peptide from wasp venom
	Chen LL1,2; Chen WL1,3; Yang HL1; Lai R*1; rlai@mail.kiz.ac.cn
	2010
发表期刊	Journal of venom research
卷号	1期号:X页码:43-47
合作性质	其它
摘要	Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residues including 15 leucines or isoleucines (32%) in the sequence. Vespin showed contractile activity on isolated ileum smooth muscle. The cDNA encoding vespin precursor was cloned from the cDNA library of the venomous glands. The precursor consists of 67 amino acid residues including the predicted signal peptide and mature vespin. A di-basic enzymatic processing site (-KR-) is located between the signal peptide and the mature peptide. Vespin did not show similarity with any known proteins or peptides by BLAST search, suggesting it is a novel bioactive peptide from wasp venoms.
关键词	Vespa Magnifica Wasp Venom Contraction Novel Peptide Smooth Muscle
资助者	This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B).
收录类别	SCI
语种	英语
资助者	This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B). ; This work was supported by the Chinese Academy of Sci- ences (KSCX2-YW-G-024), the Ministry of Science and Technology (2010CB529800) and the Ministry of Agricul- ture (2009ZX08009-159B).
文献类型	期刊论文
条目标识符	http://ir.kiz.ac.cn/handle/152453/7649
专题	科研部门_天然药物功能蛋白质学科组（赖仞）
通讯作者	rlai@mail.kiz.ac.cn
作者单位	1.Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, Yunnan, China 2.Clinical Laboratory, the First Affiliated Hospital of Kunming Medical College, Kunming 650032, Yunnan, China 3.Yunnan Clinical Research Center of Breast Cancer, the Third Affi liated Hospital of Kunming Medical College, Kunming 650032, Yunnan, China
推荐引用方式 GB/T 7714	Chen LL,Chen WL,Yang HL,et al. A novel bioactive peptide from wasp venom[J]. Journal of venom research,2010,1(X):43-47.
APA	Chen LL,Chen WL,Yang HL,Lai R*,&rlai@mail.kiz.ac.cn.(2010).A novel bioactive peptide from wasp venom.Journal of venom research,1(X),43-47.
MLA	Chen LL,et al."A novel bioactive peptide from wasp venom".Journal of venom research 1.X(2010):43-47.

条目包含的文件
文件名称/大小	文献类型	版本类型	开放类型	使用许可
2013091801.pdf（145KB）	期刊论文	出版稿	开放获取	CC BY-NC-SA	请求全文

个性服务

推荐该条目

保存到收藏夹

查看访问统计

导出为Endnote文件

谷歌学术

谷歌学术中相似的文章

[Chen LL]的文章

[Chen WL]的文章

[Yang HL]的文章

百度学术

百度学术中相似的文章

[Chen LL]的文章

[Chen WL]的文章

[Yang HL]的文章

必应学术

必应学术中相似的文章

[Chen LL]的文章

[Chen WL]的文章

[Yang HL]的文章

相关权益政策

暂无数据

收藏/分享

除非特别说明，本系统中所有内容都受版权保护，并保留所有权利。