中文版 | English
KIZ OpenIR  > 其他
Dominance hierarchy and social relationships in a group of captive black-and-white snub-nosed monkeys (Rhinopithecus bieti)
Cui LW*1,2,3; Sun QL2; Li BG*1,4; gcuilw@gmail.com
2014
发表期刊Zoological Research
卷号35期号:3页码:204−213
合作性质其它
摘要Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPT-GYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
关键词Dominance Style Hierarchy Linearity Rhinopithecus Bieti Social Relationship
资助者This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province.
收录类别其他
语种英语
资助者This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province. ; This work was supported by grants from the National Natural Science Foundation of China (31160422, 30960084), the China Postdoctoral Science Foundation (2013M542379), the Program for New Century Excellent Talents in University (NCET-12- 1079), and the Key Subject of Wildlife Conservation and Utilization in Yunnan Province.
文献类型期刊论文
条目标识符http://ir.kiz.ac.cn/handle/152453/7890
专题其他
通讯作者gcuilw@gmail.com
作者单位1.Key Laboratory of Resource Biology and Biotechnology in Western China, College of Life Sciences, Northwest University, Xi'an 710069, China
2.Faculty of Forestry, Southwest Forestry University, Kunming 650224, China
3.Kunming Institute of Zoology, Chinese Academy of Science, Kunming 650223, China
4.Institute of Zoology, Shaanxi Academy of Sciences, Xi'an 710032, China
推荐引用方式
GB/T 7714		 Cui LW*,Sun QL,Li BG*,et al. Dominance hierarchy and social relationships in a group of captive black-and-white snub-nosed monkeys (Rhinopithecus bieti)[J]. Zoological Research,2014,35(3):204−213.
APA Cui LW*,Sun QL,Li BG*,&gcuilw@gmail.com.(2014).Dominance hierarchy and social relationships in a group of captive black-and-white snub-nosed monkeys (Rhinopithecus bieti).Zoological Research,35(3),204−213.
MLA Cui LW*,et al."Dominance hierarchy and social relationships in a group of captive black-and-white snub-nosed monkeys (Rhinopithecus bieti)".Zoological Research 35.3(2014):204−213.
条目包含的文件
文件名称/大小 文献类型 版本类型 开放类型 使用许可
2014060608.pdf（334KB）期刊论文出版稿开放获取CC BY-NC-SA请求全文
个性服务
推荐该条目
保存到收藏夹
查看访问统计
导出为Endnote文件
谷歌学术
谷歌学术中相似的文章
[Cui LW*]的文章
[Sun QL]的文章
[Li BG*]的文章
百度学术
百度学术中相似的文章
[Cui LW*]的文章
[Sun QL]的文章
[Li BG*]的文章
必应学术
必应学术中相似的文章
[Cui LW*]的文章
[Sun QL]的文章
[Li BG*]的文章
相关权益政策
暂无数据
收藏/分享
所有评论 (0)
暂无评论
 

除非特别说明，本系统中所有内容都受版权保护，并保留所有权利。