A Novel Neurotoxin from Venom of the Spider, Brachypelma albopilosum

	A Novel Neurotoxin from Venom of the Spider, Brachypelma albopilosum
	Zhong YH 1,2; Song B 3; Mo GX 4; Yuan MW 5; Li HL 5; Wang P1,2; Yuan ML5; Lu QM*6; 710205373@qq.com ; yml@188.com ; lvqm@mail.kiz.ac.cn
	2014
发表期刊	PLOS ONE
卷号	9 期号:10 页码:e110221
合作性质	其它
摘要	Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPT-GYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
资助者	This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119).
收录类别	SCI
语种	英语
资助者	This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119). ; This work was supported by the National Natural Science Foundation of China (31160198, 31360417), the Applied Basic Research Key Project of Yunnan (2013FA039), the Applied Basic Research Project of Yunnan (2011FB084), the High-End Technology Professionals Introduction Plan in Yunnan province (2010CI119).
WOS记录号	WOS:000343942100043
引用统计	被引频次：3[WOS] [WOS记录] [WOS相关记录]
文献类型	期刊论文
条目标识符	http://ir.kiz.ac.cn/handle/152453/8190
专题	科研部门_天然药物功能蛋白质学科组（赖仞）科研部门_动物模型与人类重大疾病机理重点实验室
通讯作者	710205373@qq.com; yml@188.com; lvqm@mail.kiz.ac.cn
作者单位	1.Faculty of Environmental Science and Engineering, Kunming University of Science and Technology, Kunming, Yunnan, China 2.Cadres Treatment Section & Thoracic Surgery Department, the First People’s Hospital of Yunnan Province, Kunming, Yunnan, China 3.School of Basic Medical Sciences, Yunnan University of Traditional Chinese Medicine, Kunming, Yunnan, China 4.College of Humanities & Social Sciences, Nanjing Agricultural University, Nanjing, Jiangsu, China 5.Engineering Research Center of Biopolymer Functional Materials of Yunnan, Yunnan University of Nationalities, Kunming, Yunnan, China 6.Key Laboratory of Animal Models and Human Disease Mechanisms of Chinese Academy of Sciences & Yunnan Province, Kunming Institute of Zoology, Kunming, Yunnan, China
推荐引用方式 GB/T 7714	Zhong YH,Song B,Mo GX,et al. A Novel Neurotoxin from Venom of the Spider, Brachypelma albopilosum[J]. PLOS ONE,2014,9(10):e110221.
APA	Zhong YH.,Song B.,Mo GX.,Yuan MW.,Li HL.,...&lvqm@mail.kiz.ac.cn.(2014).A Novel Neurotoxin from Venom of the Spider, Brachypelma albopilosum.PLOS ONE,9(10),e110221.
MLA	Zhong YH,et al."A Novel Neurotoxin from Venom of the Spider, Brachypelma albopilosum".PLOS ONE 9.10(2014):e110221.

条目包含的文件
文件名称/大小	文献类型	版本类型	开放类型	使用许可
2014120505.pdf（644KB）	期刊论文	出版稿	开放获取	CC BY-NC-SA	请求全文