| A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity | |
| Wang YW1; Tan JM1; Lai R1,2; Lu QM*2; Du CW1; Luan N1; Yan XW1; lvqm@aliyun.com. | |
| 2015 | |
| 发表期刊 | Natural Products and Bioprospecting
![]() |
| 卷号 | 5期号:4页码:209-214 |
| 合作性质 | 其它 |
| 摘要 | Various bio-active substances in amphibian skins play important roles in survival of the amphibians. Many protease inhibitor peptides have been identified from amphibian skins, which are supposed to negatively modulate the activity of proteases to avoid premature degradation or release of skin peptides, or to inhibit extracellular proteases produced by invading bacteria. However, there is no information on the proteinase inhibitors from the frog Lepidobatrachus laevis which is unique in South America. In this work, a cDNA encoding a novel trypsin inhibitor-like (TIL) cysteine-rich peptide was identified from the skin cDNA library of L. laevis. The 240-bp coding region encodes an 80-amino acid residue precursor protein containing 10 half-cysteines. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 55-amino acid mature peptide with amino acid sequence, IRCPKDKIYKFCGSPCPPSCKDLTPNCIAVCKKGCFCRDGTVDNNHGKCVKKENC. The mature peptide was named LL-TIL. LL-TIL shares significant domain similarity with the peptides from the TIL supper family. Antimicrobial and trypsin-inhibitory abilities of recombinant LL-TIL were tested. Recombinant LL-TIL showed no antimicrobial activity, while it had trypsin-inhibiting activity with a Ki of 16.5178 μM. These results suggested there was TIL peptide with proteinase-inhibiting activity in the skin of frog L. laevis. To the best of our knowledge, this is the first report of TIL peptide from frog skin. |
| 关键词 | Amphibian Cysteine-rich Peptide Skin Trypsin Inhibitor |
| 资助者 | This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). |
| 收录类别 | SCI |
| 语种 | 英语 |
| 资助者 | This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). ; This work was supported by grants from the China National Natural Science Foundation of Young Scientists (No. 31201717), Special Foundation for Young Scientists of Jiangsu Pro- vince (No. BK2012365), Jiangsu Province Science and Technology Support Project (No. BE2012748). |
| 文献类型 | 期刊论文 |
| 条目标识符 | http://ir.kiz.ac.cn/handle/152453/9448 |
| 专题 | 科研部门_天然药物功能蛋白质学科组(赖仞) 科研部门_动物模型与人类重大疾病机理重点实验室 |
| 通讯作者 | lvqm@aliyun.com. |
| 作者单位 | 1.Life Sciences College of Nanjing Agricultural University, Nanjing 210095, Jiangsu, China 2.Key Laboratory of Animal Models and Human Disease Mechanisms of Chinese Academy of Sciences & Yunnan Province, Kunming Institute of Zoology, Kunming 650223, Yunnan, China |
| 推荐引用方式 GB/T 7714 | Wang YW,Tan JM,Lai R,et al. A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity[J]. Natural Products and Bioprospecting,2015,5(4):209-214. |
| APA | Wang YW.,Tan JM.,Lai R.,Lu QM*.,Du CW.,...&lvqm@aliyun.com..(2015).A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity.Natural Products and Bioprospecting,5(4),209-214. |
| MLA | Wang YW,et al."A Novel Trypsin Inhibitor-Like Cysteine-Rich Peptide from the Frog Lepidobatrachus laevis Containing Proteinase-Inhibiting Activity".Natural Products and Bioprospecting 5.4(2015):209-214. |
| 条目包含的文件 | ||||||
| 文件名称/大小 | 文献类型 | 版本类型 | 开放类型 | 使用许可 | ||
| 2015101321.pdf(1768KB) | 期刊论文 | 出版稿 | 开放获取 | CC BY-NC-SA | 请求全文 | |
| 个性服务 |
| 推荐该条目 |
| 保存到收藏夹 |
| 查看访问统计 |
| 导出为Endnote文件 |
| 谷歌学术 |
| 谷歌学术中相似的文章 |
| [Wang YW]的文章 |
| [Tan JM]的文章 |
| [Lai R]的文章 |
| 百度学术 |
| 百度学术中相似的文章 |
| [Wang YW]的文章 |
| [Tan JM]的文章 |
| [Lai R]的文章 |
| 必应学术 |
| 必应学术中相似的文章 |
| [Wang YW]的文章 |
| [Tan JM]的文章 |
| [Lai R]的文章 |
| 相关权益政策 |
| 暂无数据 |
| 收藏/分享 |
除非特别说明,本系统中所有内容都受版权保护,并保留所有权利。
修改评论